SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5036779|Sb03g037010 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5036779|Sb03g037010
Domain Number 1 Region: 34-335,475-678
Classification Level Classification E-value
Superfamily Subtilisin-like 1.7e-80
Family Subtilases 0.0067
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5036779|Sb03g037010
Domain Number - Region: 355-424
Classification Level Classification E-value
Superfamily PA domain 0.0139
Family PA domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5036779|Sb03g037010
Sequence length 738
Sequence
MGLHSSTRACVALALLLCFCTVSLGAHGGSRSRLYIVYLGDVRHGHPDEVIASHHDLLAT
VLGSKEDSLASMTHNYKHGFSGFAAMLTEDQAEQLAELPEVISVQPSRTFTAATTRSWDF
LGLNYQMPSELLRKSNQGEDIIIGVIDSGIWPESRSFSDEGYGPVPSRWKGECQVGQGWN
SSHCNRKIIGARFYSAGLPEEILNTDYLSPRDVNGHGTHTASTSAGSVVEAASFHGLAAG
AARGGAPRARIAVYKSLWGVGTYGTSAGVLAAIDDAIHDGVDVLSLSLAHPQENSFGALH
AVQKGITVVYAAGNSGPTPQTVANTAPWVITVAASKIDRSFPTVITLGNKQQIVGQSLYY
HGNNSSGSTFKPLAYGDLCTVDSLNGTDVRGKVVICASSIVSQLAPLSVASKNVVNAGGS
GLIYAQYTKDNTDSTAECGGIACVLVDMTSIYQIDKYMGDASSPVAKIEPARSITGNEFS
PTIAEFSSRGPSIEYPEVIKPDIAAPGASILAAEKDAYVFKSGTSMATPHVAGIIALLKS
LHPQWSPAALKSAIITTASVTDEHGMPILAEGLPRKIADPFDYGGGNINPNKAADPGLIY
DINPSDYNKFFGCAINKTYIRCNETSVPGYHLNLPSISIPNLRRPITVSRTVTNVGEVDA
VYHAAIQSPAGVKMDVEPSVLVFNSTNKVHTFQVKLSPMWKLQGDYTFGSLTWYKGQKTV
RIPIAARTTLHDFYADVA
Download sequence
Identical sequences C5XME3
XP_002456475.1.57931 4558.Sb03g037010.1 jgi|Sorbi1|5036779|Sb03g037010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]