SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5036850|Sb03g038440 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5036850|Sb03g038440
Domain Number 1 Region: 106-172,199-225
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000042
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5036850|Sb03g038440
Domain Number - Region: 198-281
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00863
Family YVTN repeat 0.049
Further Details:      
 
Domain Number - Region: 368-396
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0745
Family Hairpin loop containing domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5036850|Sb03g038440
Sequence length 524
Sequence
MAMASTRACVLPMLLAVAVLLLVEQIALSSADFPLGGQATVQLPPAPCQPGFAARAVVLD
TQGHRQPAFVAAVSAAEAGAGRCTCSLVVLLGGVKVWASDHLEKFVPAALCRLELTEDGQ
LRLTDGAGKVGWLSGTAGQGVKALHLDRKTGNLILLDAQNCIRWQSLDDPTDTFLRGQQR
RLPVHLIAPTTKAAAASSVFYSLELDGDKVAAYINFGDTRYSYWELPSPANRTMASARLN
GSGLRLLDLQGATVAQITPPVKKPPVSFLALAGDDGNLVMYYYDTQHQKFRASYKALGFC
ELPLSCSIHEVCSSAGKCKDFSDYADRPPARAAGNASSSSSNPCEGDGDKACMVHLRGVT
TVLRTASPALTNVTLRECVVECARNLSCNAALYVKDDAGGVAAAADDHGVCSHYTLTAGA
REVTDGSHLRYSYWVKFPAAAGGGDDDDDDDDSSLGKLSTGTILMICGAIDVVCAVVFVV
LIAMYFRRLRRLAAAVDRVVELQEGAAEGVGEQNDTDGNGSGHN
Download sequence
Identical sequences jgi|Sorbi1|5036850|Sb03g038440 4558.Sb03g038440.1 XP_002458695.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]