SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5036953|Sb03g040620 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5036953|Sb03g040620
Domain Number 1 Region: 518-823
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-75
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 91-177,210-244
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.66e-17
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Domain Number 3 Region: 204-305
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000233
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5036953|Sb03g040620
Domain Number - Region: 333-359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0565
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5036953|Sb03g040620
Sequence length 856
Sequence
MPASPCCLAVRRRAPFFAVLVLLQQLARFPPAAAVARTNLTAGAALTPPDYLTSPSGGFA
FGFRALDADPTRFILATWFRLGDGDPSPPPPQSVVWFAKKSTGATPNGTAQSVLSITAEG
QLVLTDGASNQVLWKAPTTTGIMQAAGTVLTLTDSGNARFLGDGGAALWESFWYPTDTLL
PGQMMVPSSQYDMTSAMLFSKRADAEFATGRFSLAAQSDGNVVLCIDLYTGDIRQNAYWA
TGTNGPDPNTTITFDDQGGLNYTLSDGSTHTLISPASSSAAGSSRCLQFVRMDPDGVVRA
YARPKSGGASASWAVTGVLPGDGGCNKRTSGMQHMCGTGSYCVETKERLSCLCPAGYTYI
DPQHHDSGCTPEFEPQICGGGDSGDNGSDQFSIVELPNTTWDMDMYKKIPSVTEEQCRAY
CLGDCFCTAALMVDGSVCVELGALSNGLQASAVTTTALIKVRTGNTLAARTSAIRRRAIL
RPYYIVTICLGIVLAITIVGLAAQHYYLTRKKKKNRNKESQQQQVLSSSVRAFSWKELHQ
ATNGFDRLLGKGNFGEVYKGTLRWPQPQAIAVKKLVESNEYSEQEFTNEVQSVGQIHHRN
LVRMIGYCKEGKHRMLVFEFMPGGSLRRFLFDPEKRLPWRWRAEAALAIARGLEYLHDGC
SAPIIHCDIKPDNILLDGHGLPRITDFGISKLLGTQQVHTTVTNIRGTRGYIAPEWLRSE
ARVDTKADVYSFGVVLLEMISCRRCQDPVEGADSDDETVTLFGWAAQLVGARRVELMLVD
GDTADDVEETERVERFARVALWCIEPNPALRPTMHLVVHMLETTERVAQVEALPADPPSC
YMESSPLIVIPQLKIE
Download sequence
Identical sequences jgi|Sorbi1|5036953|Sb03g040620 4558.Sb03g040620.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]