SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5037051|Sb03g042320 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5037051|Sb03g042320
Domain Number 1 Region: 502-793
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.75e-74
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 71-167,199-229
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.19e-30
Family alpha-D-mannose-specific plant lectins 0.0024
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5037051|Sb03g042320
Domain Number - Region: 376-429
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00196
Family Pan module (APPLE domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5037051|Sb03g042320
Sequence length 827
Sequence
MATRGGGPAAAAVLLQLLGFLFLLRGVPSRAEDDTVAAGRPLSGGQSLVSKRGKFRLGFF
QPGATDNSTQRWYLGIWYNQISVHTTVWVANRVTPISDPESSQLSISGDGNMVIVDHSSR
STVVWSTNVTATNSSTVGVILDNGNLVLADASNTSAVLWQSFDHLGDTWLPGGKLGRNKL
TGEVTHLVAWKGYKDPTPSLFALELDPRGSSQYLLNWNGSEQYWSSGNWTGTAFAAVPEM
TPTGASPVSEYTFGYVDGANESYFIYDVKDESVVTRFQVDVTGQIQFLTWVAAANEWVLF
WSEPKRQCDVYSVCGPFGVCTENALPSCTCPRGFRQRDLAQWLQDDHTAGCARNTALQPC
SAAAARDGQKKHSRRNDDRFYTMPNVRLPSNAQSTAAASAHDCELACLRNCSCTAYSYSG
GGGCSLWYGDLINLQDTTSSGTTGGSSSSISIRLAASEFSSNGNTKKLIIGLVVGGFVTA
VTAIVLATTFILRKRRIKSLRRVEGSLVAFTYRDLQLVTKNFSEKLGGGAFGSVFKGALP
DGTLVAVKKLEGVRQGEKQFRAEVSTIGTIQHVNLIRLLGFCSEGSKRRLLVYEHMPNGS
LDRHLFGASSQGQGVLSWDTRYQIALGVARGLDYLHEKCRDCIIHCDIKPENILLDDAFV
PRVADFGLAKLMGRDFSRVLTTMRGTVGYLAPEWIAGTAVTAKADVFSYGMMLFEIVSGR
RNVGQRADGTVDFFPSTAVSLLLDGDVRSAVDSQLGGSADVAQVERACKVACWCVQEDES
LRPSMGMVVQILEGLVDVNVPPIPRSLKVLADPSKYAVEFFSGLPST
Download sequence
Identical sequences jgi|Sorbi1|5037051|Sb03g042320 4558.Sb03g042320.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]