SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5037118|Sb03g043640 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5037118|Sb03g043640
Domain Number 1 Region: 104-174
Classification Level Classification E-value
Superfamily PA domain 0.000000000419
Family PA domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5037118|Sb03g043640
Sequence length 500
Sequence
MALPTIPPRALLLLLLLSVLLLAHPAAGAGTGSEFDDGTSPKFPGCDNTLQKVKVTYWVD
GDERSSLTGISARFGVVLPDAASDDQKQRAVVPSPKNGCAKSSTQLTGSVAVAVRGECTF
IEKAKAAEAAGAVAILLVNDEDDLQRMVCSDKDPPPNIGIPVVMVSKSAGDKVQSAIGNG
AKVDILMYAPLKPSFDGAIPFLWMMAVGTVACASVWTVAVVGEEPTKPGDVSLGGEENPD
AEVVELQTQTALVFIVTSSLVLLFLFFFNSVWSAWLLVSLFCLGAVHGMEFVASSLIVRL
CQRCREAKAKLPAIGNVKVVTLVMLPLAFIFALAWVTHQNSPLAWVGQNLMVATALLVAA
FFYDIFWVFISPLFFKKSVMITVARGTDDGPSLPMVLKMPKEFDSWNGYDMIGFGDILFP
GLLVAFSFRFDRTHGKDLTDGYFLCLMIGYAFGLSCTYVGLYLMKSGQPALLYLVPSTLG
VIVLLGAKRGELGQLWNAKA
Download sequence
Identical sequences 4558.Sb03g043640.1 jgi|Sorbi1|5037118|Sb03g043640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]