SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5037285|Sb03g046880 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5037285|Sb03g046880
Domain Number 1 Region: 497-789
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-72
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 68-155,184-200
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000772
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Domain Number 3 Region: 183-279
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000249
Family alpha-D-mannose-specific plant lectins 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5037285|Sb03g046880
Sequence length 793
Sequence
MAPIRLLLSLALATLLSVPVVPGAAAQAQQLATKITSGTSLQAAAGAAWPSPSGRFAFGF
YGTDGGLAVGVWLATSPNITVTWTANRNDTPSTGGALWLTYDGRLVWTGPADGQDRTLAV
PPRPAAAAAMRDDGSFVLYDANGTVVWSTFAAPAAPTDTMLPGQDLVPGAQLFSSVSLTD
RATGRYRLTNQLNDGNLVLYPVQTENTADAAYWATGTFQIGFPLTLRLDATGVLYVTGNN
GNYTKNLTRAGAPRSPGETQVLYRVTLDPDGVLRLYRHAVASGGAWTTGVQWIGPDDRCH
VKGACGLNSYCVLGGDAQPDCRCPPGFSFIDAANAPLGCTETTSAGDCATAGSAATASMV
PMQNMSWADTPYGVLGAGTSAADCQAACVADCLCAAVLLNSNDGTCTKQQLPLRYGRAGG
GYTLFVKNAAGSPSFGGGGGRGVGRSATIALVCIGVLTFVSLAALVAAARLVLTNRRTTA
EPDAALDEEAPLRSYSYQELEHATWSFREPLGRGAFGTVFRGTLPHNGGEKAIAVKRLEK
MVEDGEVEFQREVRAIGRTSHRNLVRLLGFCHEGAHRLLVYEYMSNGSLAERLFKNSSGG
PPAWGERMGIALDVARGLHYLHDELDSRVIHCDVKPQNILMDASGTAKIADFGLAKLLLP
DQTRTFTGVRGTRGYLAPEWYRGTGPVTVKADVYSYGVVLLEIVTCRRSMELEEAGEERT
LMECAHEWLVRGEVWRVVGGDEVVDAAEVERAVKVAVWCAQAEPQARPAMRSVILMLEGL
LEVPFPPPPPASS
Download sequence
Identical sequences C5XJ88
4558.Sb03g046880.1 XP_002459157.1.57931 jgi|Sorbi1|5037285|Sb03g046880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]