SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5037470|Sb04g002170 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5037470|Sb04g002170
Domain Number 1 Region: 159-243
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 2 Region: 337-410
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5037470|Sb04g002170
Sequence length 508
Sequence
MEPPSPPRPCEEEEEEEAEIDFDEEEEDPEEVEPWFTSSSDSEAEREPKRPAALEPPPPP
IPFPAPAWAVPPEQQPAPITAVEAEKKGDGDSDARPRWPGTNVFRLVVPTDKVLVSAKEE
VEAEMSPAMNAAIKIFKHINEIEEINSDGTLSASASDICSVRLLVPFEQAVHLIGKQGVT
IKSIEESTGTTVRIRDEDELLSHETVDERIVEIRGASLKVLNALKSVLELLRKFLVDHGV
LHLFERKNQEVVQPQDASNYPLAVNQDFLLSDQRSHGDPISSRLLYGHDPSFCGPHHATD
SLMIQQSRANPKGSRFLYGRDPSFHDPYSRDLSQPTDSLITKITRTMQVPLAYAEDVIGV
RGENIEYIRSVSGAVVALEEIGDYQEVQVMIEGTPSQVQTAHQLVQHHWSPRTQVIYMDD
NVAPLESKNSGYLEVISGDRAPPSRSSYYNSEGADPGLLNSPHVGSRFLHSPRAIATSRE
YLPWQYEEQTPHGHWRNPTHYDYRGYRP
Download sequence
Identical sequences 4558.Sb04g002170.1 jgi|Sorbi1|5037470|Sb04g002170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]