SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5037861|Sb04g008165 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5037861|Sb04g008165
Domain Number 1 Region: 4-84
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000024
Family Calponin-homology domain, CH-domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5037861|Sb04g008165
Sequence length 139
Sequence
RRTDAVGWLRSLFPDLPLPPEATDEDLRAVLANGRLLCALLRRLLPGALLDDAATDNAGR
FRAAIQRMGVPTFSAYDLERVSPFSLLVHATVPCINFFSFFIDVADNSSIVRIGGNVNCR
YLHSCSKGSVPITPRRRPP
Download sequence
Identical sequences 4558.Sb04g008165.1 jgi|Sorbi1|5037861|Sb04g008165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]