SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5037882|Sb04g008440 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5037882|Sb04g008440
Domain Number 1 Region: 521-792
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-73
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 117-243
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.89e-23
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5037882|Sb04g008440
Domain Number - Region: 407-446
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Pan module (APPLE domain) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5037882|Sb04g008440
Sequence length 870
Sequence
MSSPRTHKPAMPRVERLLLLFMLSIPFSQAWSIDYPSPIANLPAIWTNNEATIPYNTTYA
DGSTIRFILVRQKPAGFGPSFGCGFICTAPCKVFLFAVFFMSIGDPNNPVSNASATPRIV
WTANRHRPVKENASVLFNKDGNLVLRDFDGSLVWSTTTSDSLVVGMNLAETGNLILFNVM
GKTVWESFAHPTDTLLIGQSLWQGKRLSSTFSETNSTQGQFYLTLLDNGLYAFIDADPPQ
FYYQKSFNMADAIVKSKTNLSSEQAKNGTTYISFLQGSFSAFLRFNSTDIKLFDISLPLP
SSVQFMSLEDDGHLRVYAWDSVSWKALADVLHVYPDECAYPTVCGAYGICSQGQCSCPGG
KNDDDLFHQLDDRQPKLGCSLETPLSCDLIQYHKLMALPNVTYFNFANNWTTDEESCKKA
CLKTCSCKAVFFQHQNVSKGSCYLMPKIFSLMNYQPEVVGYNLSAYVKVQMLPPPSSKRT
NATAYHVGVPILVVVICLLILMIRRIIVKRMEEDDPFKGVAGMPTRFSYKQLREATNNFS
KKLGQGGFGPVYEGKLGNVKIAVKCLRDIGHGKEEFMAEVITIGSIHHINLVRLIGYCSD
KFHRLLVYEHMSNGSLDKWIFRKNQSGSLSWATRYKIILDIAKGLAYLHEECRQKIAHLD
IKPGNILLDEKFNAKISDFGLAKLIDRDQSHVMTKIRGTRGYLAPEWLSSTITEKADIYS
FGVVVLEIVSGRKNLENNQPEGSPNLINKLQEKMKVGQVLDIVDNQDEDLQLHGSEMTEV
IKLAVWCLQHDCRRPLEKKAQSFPAAHIVEQLADLPATADVEMERSIIHLTISCCASAKP
CNYASRKSAAGPRREPRAGWGCRAAQRAVS
Download sequence
Identical sequences 4558.Sb04g008440.1 jgi|Sorbi1|5037882|Sb04g008440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]