SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5038358|Sb04g021510 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5038358|Sb04g021510
Domain Number 1 Region: 93-168,237-258
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000324
Family alpha-D-mannose-specific plant lectins 0.0084
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5038358|Sb04g021510
Domain Number - Region: 376-413
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000549
Family Pan module (APPLE domain) 0.049
Further Details:      
 
Domain Number - Region: 234-298
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0555
Family alpha-D-mannose-specific plant lectins 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5038358|Sb04g021510
Sequence length 514
Sequence
MEAVMGRIHLVLVQCVAAAALISSLTGCGAAGEAAAAAAQELRQGFSVAHDQSYSQFKPV
LADPTGVFALGFLRVNSTMLDLAVLHLPSAFPLWRAIPDRLAPWSTPASLSFDGGLVLTN
SASNKVLWSTSASAGDRAVLLNTSNLQIQRTGASSPDVVWQSFDYPSETIVQGQNFTSAT
TLYSLDRRFAMRLGTNYFGLYIEPPPPPPSSGGGVAAAMYFRHTAMEAKAQIVAGGGPTY
ARVEPDGFLAMYQREGPPADVLSFDTFNRGVRALRRMTLEPSGNLRAYYWDGARWALDYT
AINDPCQRPTTCGAYSICAEPSGRCECLANATDGSGCAVGIGSSSLCGTTGGEVGGLYWA
VRRQGVEPANKELLWSEQAASATDCEARCERNCSCWGAVYSNGTGFCYIMDYPAQLLVAG
DDRKMGYFKVRSLEEEGRHGGGRASGVKAALLVVGVAAVVAAAAFGAYRVWVRRRRTAAD
ARRQMGAADDGLSPGLYKNLGSFSSVELTNSFRR
Download sequence
Identical sequences jgi|Sorbi1|5038358|Sb04g021510 4558.Sb04g021510.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]