SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5038547|Sb04g024410 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5038547|Sb04g024410
Domain Number 1 Region: 124-623
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-164
Family Calponin-homology domain, CH-domain 0.00000000000196
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5038547|Sb04g024410
Domain Number - Region: 12-92
Classification Level Classification E-value
Superfamily EF-hand 0.000574
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5038547|Sb04g024410
Sequence length 672
Sequence
MSTFFGVLVSDPALQSQFTQVQLRTLKTKFTSAKRPNAEHVTIKDLPPVMEKLRGIHEVL
SEEEVSKFLSETYPDMNQPIEFEPFLKEYLNLQAKGTSKSGGKKKLKGSVSFLKASTTTL
LHVINESEKTSYVNHINNFLKEDPFLKTFLPVDPASNELFNLVRDGVLLCKLINVAVPGT
IDERAINTKKDLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLIEARPHLVLGLLCQIIK
IQLLADLDIKKTPQLVELVADDNGKGAEELVTLAPDKMLLKWMNFHLKKAGYKKTVTNFS
TDVKDGEAYAYLLSTLAPELSSKTMIETSDPKERAQKVLETAEKLDCTRYVTSKDIVEGS
ANLNLAFVAQIFQNRNGLSTNTVAPVHQDTPDDVEASREERAFRLWINSLGIPTYVNHLF
EDVRTGWVMLEVLDKISPGSVNWKHASKPPIIMPFRKVENCNQVIKIGKELNFSLVNVAG
NDIVQGNKKLILAFLWQLMRTSILQLLKNLRSHSKEKEITDADILIWANNKVKESGKTSH
IESFKDKTIADGVFFLELLSAVQSRVVDWNMVKKGEDEDERKLNATYIISVARKLGCTVF
LLPEDIMEVNPKMILTLTASIMYWSLQNQGPYQCPRPQDALPEEEEGEEEEEEEEEEDFE
GGVEDGVSETTT
Download sequence
Identical sequences C5XWE1
jgi|Sorbi1|5038547|Sb04g024410 4558.Sb04g024410.1 XP_002454086.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]