SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5038980|Sb04g032460 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5038980|Sb04g032460
Domain Number 1 Region: 645-913,1019-1145
Classification Level Classification E-value
Superfamily Subtilisin-like 2.49e-70
Family Subtilases 0.0028
Further Details:      
 
Domain Number 2 Region: 37-372
Classification Level Classification E-value
Superfamily Subtilisin-like 1.96e-66
Family Subtilases 0.00015
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5038980|Sb04g032460
Domain Number - Region: 915-998
Classification Level Classification E-value
Superfamily PA domain 0.00251
Family PA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5038980|Sb04g032460
Sequence length 1305
Sequence
MASSKIALLLVLSSKLLLAATALHDDDDDTLALQGGQHEAVWSTSNMGEGVIIGVLDDGI
DAGHPSFGDEGMPPPPTRWRGRCKHAGVASCNSKLIGARDFTRHLRRPGTAPRPGTHGTH
ASSVAAGAFVRRAGGAPAGAPVVVVSGVAPRAHLAFYQVCAGAARGCSRGSVVHAVEAAL
ADGVDVLSLSLGDDDGLGFHEDPVVAATFSAVVRGVFVCAAAGNKGRTPGSVANDAPWIL
TVGASSQSQQGGAPRSAATIPGFSSRGPSRNNGGVMKPDIVGPGVDILGAVPRSARGQSF
ASLSGTSMAAPHLSGVAALIKSAHPTWSPAAIKSAIMTTADASLTDETGTPASYFAMGAG
LVDAAKAIDPGLVYDTSPEEYIPYLCGLGYTDEQVNRIIYPAPAVHCAEMENTEAKDLNA
PSIMVALTVDGPAVTVSRTVTNVGAARSVYRVDVSAPDGVSITVVPGELQFDEVNQKASF
VVTMERAAPGSALESEILGAQLAWVSEEHVVLCSSMDDPPNPMRIAALVSLRAAVFFLAL
LLVSTAVAHNDHGLHKNYLIIVRTPYEYDRSMFKDVSDWHASLLASVCDMAEEELNKDPA
AMARLIYSYRHVVNGFSARLTVDEVREMAGMDWFVKAIPEKTYRLMTTHTPQMLGLNGKG
SRGGLWNKSNMGEGIIIGVLDDGISPGHPSFDGTGVPPPPAKWKGRCDFNSSVCNNKLIG
ARSFYESAKWKFQGVDDPVLPVSTGSHGTHTSSTAAGAFVPGANVMGNGLGTAAGMAPRA
HIALYQVCFEDKGCDRDDILAALDDAVDEGVDVLSLSLGDDEAGDFAYDPIALGGYTAIM
KGIFISAAGGNMGPDPATVANEAPWLLTVAAATTDRRFVASVRLGNGVELDGESLFQPQG
FLSLPRPLVRDLSDGTCSDEKVLTPEHVGGKIVVCDAGGNLTSLEMGAALREAGAAGMVV
ITIVEFGSVIQPKAHALPASQVTYSTGQKIRAYMNSTDMPTGELIFKGTVLGNRDSPVVA
AFSSRGPSKQNQGILKPDITGPGVNIIAGVPKPAGLMTPPNPLAAKFDVLSGTSMATPHL
SGVAAVLKKAHPTWTPAAIKSAIITTADPKDRSGKPIAAHDGSPASLLTLGAGFVDPMKA
MNPGLVYNLTALDYIPYLCGLRYSDHEINSIIHPLPPVACAQMAVVEQKDLNYPSITAFL
DQEPYVVNVTRVVTNVGRAVSVYVSKVEVPSTVSVTVDPEMLVFRKVNEAKRFTVTIRST
DTSIQEGIAEGQLAWVSPKNVVRSPILVSFKKFVKDNSTTAHLRH
Download sequence
Identical sequences 4558.Sb04g032460.1 jgi|Sorbi1|5038980|Sb04g032460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]