SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5039111|Sb04g034950 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5039111|Sb04g034950
Domain Number 1 Region: 117-162,190-392,499-627
Classification Level Classification E-value
Superfamily Subtilisin-like 3.4e-77
Family Subtilases 0.0072
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5039111|Sb04g034950
Domain Number - Region: 374-447
Classification Level Classification E-value
Superfamily PA domain 0.0157
Family PA domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5039111|Sb04g034950
Sequence length 780
Sequence
MARLASALCVLLAAAVAVPAAVATESEAVEPVSTYIVHVAPAHAPRLSRPRALSGAYRSF
LRDHLPARVARPAPRLLYSYAHAATAFAARLTGAQAAHLASQRSAVLAVVPDATQQLHTT
LTPSFLRLSESSGLLQASGGATDVVIGLIDTGVYPKDRASFDADPSLPPPPSTFRGRCVS
TSAFNASAYCNNKLVGAKFFGLGYEAAHGGEVGETDSRSPLDTNGHGTHTSSTAAGSAVA
NAAFFDYGKGTATGMAPRARIATYKACWARGCASSDILKAFDEAIKDGVNVISVSLGAVG
QAPPFYSDSTAVGAFSAVRNGIVVSASAGNSGPGEFTAVNVAPWILTVGASTLNRQFPAN
VVLGSGDTFTGTSLYAGTPLGPSKLPLVYGGSVGSSVCEAGKLIASRVAGKIVVCDPGVI
GGAAKGEAVKLAGGAGAIVVSSKAFGEEALTTPHIHPATGVSFAAAEKIKKYIRTSASPV
ATIVFIGTVVGGTPSSPRMASFSSRGPNLLAPEILKPDVTAPGVDILAAWTGENSPTELD
SDTRRVKFNIISGTSMSCPHVSGIAALLRQAWPDWSPAAIKSALMTTAYNVDNAGDIIKD
MSTGTASTPFVRGAGHVDPNRALNPGLVYDVGTDDYVSFLCALGYTARQIAVLTRDGSTT
DCSTRSGSVGDLNYPAFSVLFGSGGDEVTQHRIVRNVGSNVRATYTASVASPAGVRVTVE
PPTLKFSATQQTQEYAITFAREQGSVTEKYTFGSIVWSDGEHKVTSPISVIWLASQAAEM
Download sequence
Identical sequences C5XTM2
4558.Sb04g034950.1 jgi|Sorbi1|5039111|Sb04g034950 XP_002452918.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]