SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5039113|Sb04g034960 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5039113|Sb04g034960
Domain Number 1 Region: 16-343
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 5.89e-52
Family SGL-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5039113|Sb04g034960
Sequence length 346
Sequence
MAIHKLARTLAILCLAVLLLLLPCAARPISETRTIDGSRSKHLPLRGSMLRGPESVAFDG
AGAGPYSGVSDGRVLKWNGFARGWSTYAYSPGYDAEACTASRTRPAELTESRCGRPLGLR
FHHRSGNLYIADAYKGLMRVGPGGGEATVLAAEVDGVPLRFTNGVDVDQVTGDVFFTDSS
MNYPRSQHERVTATGDSSGRLMKYDPKTGQVTVLQAGVTYPNGLAISADRTHLVVALTGP
CKLLRYWIKGPKAGTSEHLADLPGYPDNVRADGRGGFWVALHREKMELPFGPDSHLLAVR
IGADGQVVQVMKGPKSVRPTEVVERDGGKLYMGSVELPYVAVVREY
Download sequence
Identical sequences C5XTM4
jgi|Sorbi1|5039113|Sb04g034960 XP_002452919.1.57931 4558.Sb04g034960.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]