SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5039475|Sb05g002480 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Sorbi1|5039475|Sb05g002480
Domain Number - Region: 43-79
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000785
Family SGL-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5039475|Sb05g002480
Sequence length 84
Sequence
MKKTAVLAVLAAIAAAALLSSSDDSRRDVTVLEIGGSDDGRVELVPVDAGAAGPESLAFD
AAGVGPYVGVSDGRVLRWVPGERR
Download sequence
Identical sequences 4558.Sb05g002480.1 jgi|Sorbi1|5039475|Sb05g002480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]