SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5039523|Sb05g003110 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5039523|Sb05g003110
Domain Number 1 Region: 345-629
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-72
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 91-199
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.93e-22
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5039523|Sb05g003110
Sequence length 672
Sequence
MAMQYFNILVTFFLLLGFPFHPTVDGQLSTIAPPQSWEISGMRDTNGEDTTSMTPVLVNS
TELYRTMFGFYTTDGGHSFILSVQFLGAQAQVIWSANPDNPVSRNAILNFTREGDLLLHE
ADGAIIWATDTNSLSVAGMKLDDLGNLVLFNQNNTTVWQSFDHPTDTLVLGQSLCRGNNL
SAKTLSTKWPGSRVYLSAELDGLQYSFKPAAYTQLFQATTTSTNATPTCYAFVNGSFGFP
YKIFSIPLAESVQLMRVVLFQRSSYSDDDAGNCLLLSEQNLILFADGSSNDLLALFKIQD
KHSVKRRNITIGSTIAGFSITSIFISAVIWKKCKKDEEPLFDGIPGIPKRFSFHELKVAT
SNFSIKLGAGGFGSVFKGTIGKETIAVKRLEGVHQGMEEFLAEVKTIGRIHQLNLVRLVG
FCAEKSHRLLVYEYLSNGSLDKWIFHTSLVFTLSWKTRRNIILAIARGLSYLHEECEEKI
AHLDIKPQNILLDNKFNAKLSDFGLSKMINRDQSKVMTRMRGTRGYLAPEWLGSTITEKA
DIYSFGIVMIEIICGRQNLDESQPEQSIHLISLLQEKAQSGQLFDLVDSSSDDMKSNVED
IMQTMKLAMWCLQVDSSRRPLMSTVAKVLEGAVSMEATPDCIFVPNFASFNTDVTGSTSS
YVPSESQLSGPR
Download sequence
Identical sequences 4558.Sb05g003110.1 jgi|Sorbi1|5039523|Sb05g003110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]