SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5039766|Sb05g005770 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5039766|Sb05g005770
Domain Number 1 Region: 297-580
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-75
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 187-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5039766|Sb05g005770
Sequence length 631
Sequence
MQHYLRRCECAVPVRLWALRLLLAGAQPHLRHQPLPPTVASRRQRHTPGRRHLLARLHSA
RHRPLYSSTDWTTEVDHSVGYDISVPYERNFTKRRLVADVRLPDIGQHYVLSTRNEFIVI
SGWDVRATLYGEYYRNGSSSNTSDSIISRAVCSSGNNGSCHAPISSGSAPKRVEFKELSI
NVSQHHDIDECNVPGLRYSCLGGYCNNLPGNFECQCPPGTHGNASETGGCVTRSPTGLII
GLSVASGPALLLLVLGILFLLRKLKQRRTKLLKQKYFKQNRGQLLQQLLFQKADIAERMI
ISLDELAKATNNFDKAREIGGGGHGTVYKGILSDLHVVAIKKSKITVQKEIDEFINEVAI
LSQINHKNVVKLFGCCLETEVPLLVYEFISNGTLYHHLHVEEPRSLSWASRLRIATEIAA
SLAYLHSSVSIPIIHRDIKSSNILLDDTMTSKISDFGASRYIPGDKTGLTTRVQGTIGYL
DPMYFYTNRLTERSDVYSFGVILVELLTRKKPFLYLSSEGDGLVSHFVNLISEGNLSQII
DPQVTEERGTQVQEVATLAASCINSRVEERPTMRQVEHTLHELQGPNSYNRDGIVAVEPT
NDSITTDNPSLSGQGQRYENPCSRRYSLEQR
Download sequence
Identical sequences jgi|Sorbi1|5039766|Sb05g005770 4558.Sb05g005770.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]