SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5039767|Sb05g005780 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Sorbi1|5039767|Sb05g005780
Domain Number - Region: 139-183
Classification Level Classification E-value
Superfamily Pyruvoyl-dependent histidine and arginine decarboxylases 0.0225
Family Arginine decarboxylase 0.023
Further Details:      
 
Domain Number - Region: 274-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0327
Family EGF-type module 0.057
Further Details:      
 
Domain Number - Region: 13-23
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5039767|Sb05g005780
Sequence length 361
Sequence
MALQLSASAATVPPPRPTPPPPPAPIGQPGCNTTCGHVSVPYPFGYGPSRCYWPGLNLTC
DTSHGHPPRLLLGDGTLRVAEISLSSETVRVVPTGLIIDTTGDLTSPGWNASVEFGRGFR
EHGYLLSARNELIVTGCNVVATLSADIVGEETTKIVSGCASFCTKSDHEDVGYIYDHHEA
SYTAAFLASSGVPNRAQARWLYSGNHTLEQTDMPVSVVVMEQGWIDNPRKTAEETDEFDE
DAPPLLLDFAVAQGLPPHSKGNSNCSQDVHRMVCKSEHSDCVAPVAGYTCHCKDGFEGNP
YLAGAGGCQDVAFLAVPAAAGAMALTSHRCPCARCHLIWGRRWCRLAYLDPKVVDDGGHG
I
Download sequence
Identical sequences 4558.Sb05g005780.1 jgi|Sorbi1|5039767|Sb05g005780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]