SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5040790|Sb05g023820 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5040790|Sb05g023820
Domain Number 1 Region: 575-868
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-75
Family Protein kinases, catalytic subunit 0.0000895
Further Details:      
 
Domain Number 2 Region: 460-505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000894
Family EGF-type module 0.0055
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5040790|Sb05g023820
Domain Number - Region: 272-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5040790|Sb05g023820
Sequence length 889
Sequence
MGFLAHHSPPLLTTVTVVLLAYAGAAAVAAAQGSAAGDNGAAAAVVPSAASLAGCPKTCG
NLSIAYPFGIGAGCFRDPDFELICNTTTTQPRLFLTGGDTEVVADIDPTYTYGTGVRVAF
SRSVPIIPGVQVYNTSWTKPPGRSFTGFDHYLQLDFTGCDFNVSWLLDDGSANFLCKVTC
PSEGIMDEAMARQQCNGTGCCSYYIFLYGSRTVSSLNLQFVRNDDPKANPKQPNSSLWDR
ISVESDGMWLSWVVADEPSCAAASVNKTKYACVSKHSTCTDKLPSYVCMCEPGYSGNPYV
ADGCMRDTGYNPAPRKANCSRSCGDITVPFPFGLDEGCSARKELQLDCTDKKLFWGEFLE
SHYVSHINISEGTMGVTRTDSYVAPGYFYTSSAISQDLNWVVANLTCQEAPQNITTYACI
SLNSACLGVNSANEDSQQYVGYRCKCKAGFQGNPYVLNGCQDIDECAMTPGICSGQQCQN
TIGSYHCTECPYKTHYDSTVMRCIHEKRKLSLLSGIMIGFGAGFGILLLALCATFAILRW
RRHAQRRLRRQYFHQNKGLLLEQLISSDENTNDKTKIFSLEELEKATNNFDETRILGRGG
HGMVYKGILSDQRVVAIKVSKVIEQSEINQFINEVAILSQISHRNIVKLFGCCLETKVPL
LVYDFISNGSLYDILHPSLESKFSLSWEDCLRIAAEAAGALYYLHSAASVSVFHRDVKSS
NILLDANYTAKVSDFGASRLVPIDETHVDTLVQGTFGYLDPEYYHTGQLNEKSDVYSFGV
VLVELLIRRKPIFTNETGSTQNLSSYFLSEFNSRPIEEIIAAEIREEATKEEISSVASLA
KMCLMLRGQDRPTMKQVEMALHTLLTKRAKYRIIGTRENNHDMQPLLYS
Download sequence
Identical sequences A0A1Z5RJS4
4558.Sb05g023820.1 jgi|Sorbi1|5040790|Sb05g023820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]