SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5040907|Sb05g025030 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5040907|Sb05g025030
Domain Number 1 Region: 523-696
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.2e-27
Family Protein kinases, catalytic subunit 0.004
Further Details:      
 
Domain Number 2 Region: 79-195
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.5e-20
Family alpha-D-mannose-specific plant lectins 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5040907|Sb05g025030
Sequence length 722
Sequence
MTRLLSSYLLTVIFTVFLLLLKASAAGTPSDTLSSSSNITDGETLVSSGSSFTLGFFSPA
GVPAKRYLGVWFTMSPEAICWVANQETPLNNTSGVLVVDDSTGTLRLLDGSGHTAWSSSS
STTTTSSAPPPPVVLPQAQLLDSGNLVVRDQSTGDVLWQWFDHPGNTYLAGMKFGKNLRT
GAEWTTTSWRASNDPAPGDYWRSLDTRGLPDTITWHGNVKMYRTGPWNGQWFSGIPEMAS
YLDLYSNQLVVGADEIAYSFNTTAGAPISRLLLNENGVMHRLGWDPVSLVWTSFAEAPRD
VCDNYAMCGAFGLCNMNTASTMFCSCAVGFSPVNPSQWSMRETHGGCRRDVPLECGNGTT
TDGFKMVRAVKLPDTDNTTVDMGVTLEQCRERCLANCACVAYAAADIRGGDHGCVMWTDA
IVDVRYIDKGQDMYLRLAKSELVEKKRNVVLIILLPVTTCLLALMGMFFVWVWCRRKLRG
KRRNMDIHKKMMLGHLDETNTLGDENLDLPFFSFDDIGILGENREVAIKRLSQGSGQGTD
EFRNEVVLIAKLQHRNLVRLLGCCIHGDEKLLIYEYLPNKSLDSFIFDAARKNVLDWPTR
FRIIKGISRGVLYLHQDSRLTIAWSLWNDGKAMDLVDSFVLESCSANEALRCIHIGLLCV
QDNPNSRPLMSTVVFMLENETTLLSVPKQPMYFSQWYLEAQGTGENTNSSMNNMTVTVLE
GR
Download sequence
Identical sequences jgi|Sorbi1|5040907|Sb05g025030 4558.Sb05g025030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]