SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5041106|Sb05g027090 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5041106|Sb05g027090
Domain Number 1 Region: 351-514
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-39
Family Protein kinases, catalytic subunit 0.00093
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5041106|Sb05g027090
Domain Number - Region: 268-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000486
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5041106|Sb05g027090
Sequence length 632
Sequence
MASPPTPAPPLPDRRCPSKCGTVDIPYPFGISADCAWPGGGNFTIDCNQSFNPPRPYTNG
NVEITSISVETGEMHVYAIVASVCYNSSNTTDFDQGSIGWYLLPPLLISPTENVFTAIGC
AALALLEGGSDWNYFTGCISYCASLNDSAQDGDRCTGHGCCQTSILGNLSTIEVGWSTTD
NNTAGNSFAWEYSPCKHAFVAQKDCRQDLSGKGKDSFSSRVGERSAPLVLDWAIRGNGSC
KMELDTSGVSLSDINECTEVRQQSNSTRYGPCGPNSTCKDTDGDYICKCKFNHKGDAIAV
AIILACFAGFLLQKRKRRKLSDKNGRRILEGHGVTMYSERELNKITNERKLFLGEGKYGK
VYEGRIDGKPSQLVAVKYSVVQRNWLKAIQQLAQQEQDDDGAFVNEIKFQFRIRHINVVK
LIGCCLETKIPILVYELVSNGSLEKRLHDGDKRFTLSLLKRLDIAIGSAEALSHIHSHGD
HVHGDVKPANILLDDDLNPKVSDFGSSKLLSVNSLPLAFGKCFKDEGSGRKMYDIEVFSG
DGAQFQRNMQCLDMIACATNRTLQWPGTATTELDRGSTDSAMNSGRGSAHARAKEGEDLQ
LRYEQRLRHVLLLLVNLHLILSDAINSSGLYY
Download sequence
Identical sequences jgi|Sorbi1|5041106|Sb05g027090 4558.Sb05g027090.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]