SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5041344|Sb06g002200 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5041344|Sb06g002200
Domain Number 1 Region: 499-789
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-73
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 66-199
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.45e-17
Family alpha-D-mannose-specific plant lectins 0.0061
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5041344|Sb06g002200
Domain Number - Region: 376-412
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0192
Family Anti-platelet protein 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5041344|Sb06g002200
Sequence length 808
Sequence
MNNGFMAPLLLLPFLLLLSSPSMKAQQNILLGSWLTPTQGSNSSWHSQSGDFAFGFRPVE
GNSSLFLLAVWFNKISDQTVVWYAKASDPDPAPIQVSSSSHLQLDSSGVLSLKDSTGIEV
WNPNAVGAAYATMLNTGNFVLAAADGSTKWGTFNNPADTILPTQVLTPGMALRSRIIPTD
YSNGRFLLDVADDGVFFHSVAVPSGYQYNPYWVMPGNKTTKLVFNETGVIYMTLDGNIEI
NITSGPDITGPMEDYYHRATLDTDGVFRQYVYPINRGEWSLVTAWTVVGFSPPNICETLT
EVGSGICGFNSYCQFDSASSNLSCLCPPQYSFLDEERKYKGCKPDFQTQGCELDEASAMA
QFQLTWQDNVDWPLADYEIYTPVTENQCRRLCLIDCFCTVAVFHDSDNTCWKKKTPLSNG
KMMHSVQRTLLLKLPKNNISQTELINVSGKWKKDKMHWILGGSMLLGSSVLVNLLLTLVL
LFGTYRVITIIKIAQPLQSSSNLGLPLKAFSYTELDKATGGFTEVLGTGASGIVYKGHLE
DNLRTCIAVKKIDKLQKETEKEFTMEVQAIGQTYHKNLVRLLGFCSEGSERLLVYEFMAN
GSLSGLLFGDVRPQWNLRVQLALGVARGLLYLHEECSTQIIHCDIKPQNILLDDKLTAKI
SDFGLAKLLQTNQTQTNTGIRGTRGYVAPEWFKSIGITAKVDVYSYGVILLELISRRRNV
ELEAAEDKKILTYWASDCYRCGRVDLLVEADAEAISNLKVVERFVAVALWCLQEDPTIRP
TMLKVTQMLDGAEAIPSPLDPSSFFSSV
Download sequence
Identical sequences jgi|Sorbi1|5041344|Sb06g002200 4558.Sb06g002200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]