SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5041428|Sb06g003330 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5041428|Sb06g003330
Domain Number 1 Region: 78-112
Classification Level Classification E-value
Superfamily PA domain 0.000000615
Family PA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5041428|Sb06g003330
Sequence length 165
Sequence
MSPRVVLLFLAAALRPCAALVRLHSATFSFTFLDAPARFGPRVGGDGICGSLRAAEPAEA
CEPIKDRGGRRGTGRKAFVLIARGNCSFEEKVRAAQQAGFDAAVVYDDEEKSSLYSRRNN
SFPTLFIASFACYLEQYKNEGKEKHGSIVLISKLAFELDGYSQAE
Download sequence
Identical sequences jgi|Sorbi1|5041428|Sb06g003330 4558.Sb06g003330.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]