SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5042012|Sb06g019450 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5042012|Sb06g019450
Domain Number 1 Region: 378-674
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.63e-103
Family Motor proteins 0.00000152
Further Details:      
 
Domain Number 2 Region: 20-160
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-24
Family Calponin-homology domain, CH-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5042012|Sb06g019450
Sequence length 963
Sequence
MAPAAAGAHDVGMALRKAEEAAARRCEAARWLRQMEPAAAESLPERPSEEEFCVALRNGL
VLCKVLNRVNPGAVPKVVENPVITVQTFDGPAQSAIQYFENMRNFLVAVSAMNLLMFETS
DIEKGGSSMKVVDCILCLKGYHEWKISGGIGIWRYGGIVKIASSSKRPASHLNRGGGSDQ
QMLEFVHLLSEVSLEESRVEEAQHSLFQRFVLQVVRAFLLEWGEAEDLPLDDMVIETVLE
QACKEFTILLASHRNQVRSLLRKMMKDDNGTLSKMDLIQTISKCLKENSECMFSSLRVPR
GSHEHLDGEGLLESQQEELEKLKMSFNEMKLQVESTRADWAEDLRRLESYFEAQNHSAYR
KLLEENRKLYNQVQDLKAEVFADTQPLIRSVMDGYNVCIFAYGQTGSGKTYTMSGPDVTA
EETWGVNYRSLNDLFGISQTRADSITYDVKVQMIEIYNEQVRDLLMTDEIRNNSHVNGLN
IPNANIVPVKCAQDVLDLMKVGQRNRAVGSTALNERSSRSHSVLTVHVQGKEVISGSILR
GCLHLVDLAGSERVDKSEATGERLTEAKHINKSLSALGDVISALAQKSSHVPYRNSKLTQ
VLQDALGGQAKTLMFVHVNPETDSFSETMSTLKFAERVATIELGAARANKEAGQVKDLKE
EIAKLKLALDEKEHEAAQFKDLANRVTSEMRNARTRSPLTASMSLKPEASQESSVDTCTS
EIRSSSSGKQRRFRSPLSVRELDDKSPVITRELYLSARKYKTPSPPVRSSLSAERGSFAK
IVENTGSIDCTPISKVEVPPKVLSSNSKNTPSSVLTVQSLRKFRDSEENRTKIPPIRQSM
VKNRSESTPKAHNEEKSANRHSGTKVRSEVRSTRDSSEIENEFSGDEPTFHFNRKAKKLP
TQVTRQSQNIDISVRASVREMEPLTEGRQRRNWSKPPYAERTNVPLPDIRRSVSLPRGKN
LLA
Download sequence
Identical sequences 4558.Sb06g019450.1 jgi|Sorbi1|5042012|Sb06g019450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]