SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5042043|Sb06g019890 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5042043|Sb06g019890
Domain Number 1 Region: 487-778
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-73
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 60-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.68e-23
Family alpha-D-mannose-specific plant lectins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5042043|Sb06g019890
Sequence length 799
Sequence
MAHIFFLLLWLPLSCSYTLAQHNISLGSTLNPEGPNRSWLSPSGDFAFGFRPLETNSSQY
LLGIWFDQINENIIVWYAKSNGTTAVSSGSSLQFTVNGSLSLRNSTGAEIWSSQIAGGAY
ASMNDNGNFVLYGADGSPKWQSFTTPTDTILPSQELPSGTILHAKLMDTDYSNGRFILSL
ETDGNLTFYSVAVPTGFKYDGYWSTNTSGNGGKLVYDTNGTIYYALENNMKRIMQAEMDS
TDQYYHWAKLDPDGVLRQYKYPKREAVRSGLPAEWTVVQAMPANICNIVYTDFGSGVCGY
NSYCMLNWNQTETECSCAPHYSFFDTERKYKGCKPDFALQSCDLSEAQVLEQFKMIPMNH
IDWPHRAYEEYYPIDETTCQSLCLNDCFCAAAVSDHTGYCWKKKLPLSNGNEGSEVQRTV
YLKVPKDNYSQTLLNIEASSKWKTNRKDWILGGSIIIGSSVFLNFLFISAHFLGAHFRAN
REKNHLRAWTRMMTRDFTYRELEEATNGFNEEVGRGASGVVYKGYLHGEFDTSIAVKKII
DRIPQETEKEFTMEVQTIGHTLHKNLVQLLGFCYEGAERLLVYPFMPNGSLTKFLFSGKK
PAWALRVDIAHGVARGLLYLHEECGKQIIHCDIKPENILLDNNFIAKISDFGIAKLLKAE
QTKTSTGIRGTRGYFAPEWFKNVRISSKVDVYSFGIVLLEIVCCRRNVDLQSNDDEQVVL
AYWAYDCYRCSRLDLLVESDEEAIINMKIVERFMRVALWCIQDEPEMRPTMLKVTKMLDG
AIEVPQPPIDTPTFISLWH
Download sequence
Identical sequences A0A1Z5RDF3
4558.Sb06g019890.1 jgi|Sorbi1|5042043|Sb06g019890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]