SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5042212|Sb06g022980 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5042212|Sb06g022980
Domain Number 1 Region: 548-839
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.35e-75
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5042212|Sb06g022980
Domain Number - Region: 441-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000222
Family EGF-type module 0.0097
Further Details:      
 
Domain Number - Region: 249-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0484
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5042212|Sb06g022980
Sequence length 898
Sequence
MTTLLPLVALLLAAAAAGGSCPATCGTIDISYPFGVGPACSLPGFNLTCDSSTYSSLLWL
RLGSPNVTVDYMTVSASGSITALAARVMRSVNVPAAAADYYASWEGPGRPFAISGSSNMS
LFVVGCGFAAALLDSGTGAAVGNCSVICAGEQVMERLPDGLCAGVGCCRIDVRVPLRAFV
LNLSRTGEGVIGDRVTFLVTGRDGYTFRASNLEQGIVAGEVAPALLDWAIPDRADCALAA
ADRASYACVSNNSECQDSPIGGYVCHCSQGFLGNAYVVDGCVPNQVYGSRQPKVNCPTMC
GNVSIPFPFGMELGCFARIHLYLACNPGPTPPILQMTEHSVVTDISIDQGILRIQKLSDP
GGFLDGQDSAFYAFSGESGVVKWAVDNLTCRYAMANKDQYMCVGTHSECIEVTDDRTSRH
VGYRCRCSSGFEGNPYIEDGCTDIDECLQPDKYICHGVCQNSLGSFSCTDCPHGTEFDTA
ARKCKASSTILGITIGISSGGGLLFLAAIAVILNRRWKKGVQKQLRRRYFRKNKGILLEQ
LISSDQNASDSTKIFSLAEIEKATNNFDQARVVGRGGHGTVYKGILTDQRVVAIKRSKLV
ANSEIDEFINEVAILSQINHRNVVKLHGCCLESEVPVLVYEFISNGTLYELLHGQRNNGS
LLPLPWEERLRIATEVAGALTYLHSAASMSVLHRDVKSMNVLLNDSYTAKVSDFGASRLI
PIDQTHLVTAVQGTFGYLDPEYYHTGQLTDKSDVYSFGVILAELLTRKKPIIEKENGEKQ
NLSDYLGAAKEKPLEDIVDDQVLEEASKETIMCFARLAQECLDLRREARPTMKDVEVRLQ
LLKGRTAASRSRADGEFRRPGETGRGDRRRGVVPVTGQDGTRQYSLEQEFASSLRIPR
Download sequence
Identical sequences C5YCG2
jgi|Sorbi1|5042212|Sb06g022980 4558.Sb06g022980.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]