SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5042329|Sb06g025110 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5042329|Sb06g025110
Domain Number 1 Region: 102-354,464-587
Classification Level Classification E-value
Superfamily Subtilisin-like 6.06e-80
Family Subtilases 0.0024
Further Details:      
 
Domain Number 2 Region: 336-441
Classification Level Classification E-value
Superfamily PA domain 0.0000000785
Family PA domain 0.0097
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5042329|Sb06g025110
Domain Number - Region: 43-92
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0213
Family Subtilase propeptides/inhibitors 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5042329|Sb06g025110
Sequence length 732
Sequence
MGSSKLPLLPILLLAVVVATVSGDELRTFIVHVQPHESHVFSTSDDDRTTWYKTFLPEDE
RLVHSYHHVASGFAARLTQQELDALSGMPGFVTAVPNQVYQLLTTHTRQFLGLELPQSGR
NYTSGFGEGVIIGVLDTGVYPFHPSFSGDGMPPPPAKWKGRCDFNASACNNKLIGARSFE
SDPSPLDHDGHGTHTSSTAAGAVVPGAQVLGQAAGTASGMAPRAHVAMYKVCGHECTSAD
ILAGIDAAVGDGCDVISMSLGGPTLPFYQDGIAIGTFAAVEKGVFVSLAAGNDGPGDSTL
SNDAPWMLTVAASTMDRLIAAQVRLGNGSTFDGESVFQPNISTTVAYPLVYAGASSTPNA
SFCGNGSLDGFDVKGKIVLCDRGNKVDRVEKGVEVRRAGGFGMIMANQFADGYSTNADAH
VLPASHVSYAAGVAIKEYINSTANPVAQIVFKGTVLGTSPAPAITSFSSRGPSVQNPGIL
KPDITGPGVSVLAAWPFRVGPPSTEPATFNFESGTSMSTPHLSGIAALIKSKYPDWSPSA
IKSAIMTTADPDDKSGKPIVDEQYVPANLFATGAGQVNPDRALDPGLVYDIAPAEYIGFL
CSMYTSKEVSVIARRPIDCSAITVIPDLMLNYPSITVTLPSTTNPTAPVMVSRTVKNVGE
APAVYYPHVDLPASVQVKVTPSSLLFTEANQAQSFTVSVWRGQSTDDKIVEGSLRWVSNK
HTVRSPVSISFA
Download sequence
Identical sequences jgi|Sorbi1|5042329|Sb06g025110 XP_002448316.1.57931 4558.Sb06g025110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]