SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5042598|Sb06g029690 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5042598|Sb06g029690
Domain Number 1 Region: 55-147,178-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.81e-26
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5042598|Sb06g029690
Sequence length 218
Sequence
MAYLPIFIFLFMVVLCQSDDRLTPAKPLLPSEVLISDGGVFALGFFSLKNSSSSYVGIWY
NNIPGRTYVWIANRDNPITTNLPGKLVFTNSSDLVLLDSTGRTIWMTTNNSTTGGGETAS
ILLDSGNLVIRSPNGTDIWQSFNYPTDTVVPNVNFSLSVAYGATRLVAWKGPDDPSSSDF
SLGGDPSSDLQIVAWNGTQPYWRRAAWGGELETGTICN
Download sequence
Identical sequences 4558.Sb06g029690.1 jgi|Sorbi1|5042598|Sb06g029690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]