SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5042599|Sb06g029720 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5042599|Sb06g029720
Domain Number 1 Region: 503-602
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.9e-28
Family Protein kinases, catalytic subunit 0.002
Further Details:      
 
Domain Number 2 Region: 73-157,189-216
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.05e-22
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 
Domain Number 3 Region: 351-425
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000628
Family Hairpin loop containing domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5042599|Sb06g029720
Sequence length 607
Sequence
MAALLLLPIFVFIITSPCQSESDDTLTQAKPLYPGDTLVSRNGVFALGFFSPSNSNESLY
LGIWYQYNGTRDVTVWVANRDNPVTTSAKLAITNDQQLALLSDSGRALWTTTTTAAAAAT
TTTGVVAVLLNSGNFVLRSANGGGTAIWWQSFDHPSATILPTMKVLLSYKGIVNTSIVAC
KSPGDMSPGDFSGSIDPSSNLQFFVWNSGRPYYRISFFDDVSVFSFGGGATSAVVHPSVI
NTGDEVYYTYNVNVSHHGSPLTRVLLKHDGSMSLLTRQNSNTTSSQWTPSFERPGPGCDL
YASCGAFGYCDHTEAVPSCRCLDGFEPIDGLDISRGCRRNDALECGGGEDRFVTLPGMTV
PDKFLQIGNTTLEQCAAECSANCSCTAYAYVNVSSAGALVDTSMRCLLWTGDLVDTGKAS
AASSGQNLYLRLARSHVQHKRISLKFLLPIIACLLLLASIAFFLTCKYRGKRQKKKTERR
KMLEYLRSTDEAGENLESPFISFEDIVAATDNFADSNELGKGGFGKVYKGVLQGTKEVAV
KRLSKGSGQGTEEFRNEAVLIANLQHKNLVKLIGCCVHQDEKLLVYEYLPNKSLDYFIFG
TFIFFIP
Download sequence
Identical sequences jgi|Sorbi1|5042599|Sb06g029720 4558.Sb06g029720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]