SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5042600|Sb06g029725 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5042600|Sb06g029725
Domain Number 1 Region: 1402-1715
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-82
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 498-787
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-77
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 3 Region: 976-1068,1100-1108
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-27
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 
Domain Number 4 Region: 66-177
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.15e-25
Family alpha-D-mannose-specific plant lectins 0.0067
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5042600|Sb06g029725
Domain Number - Region: 1257-1303
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0337
Family Hairpin loop containing domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5042600|Sb06g029725
Sequence length 1735
Sequence
LPVFLLSFRASAAGTASDTLSSSSNITDGETLVSSGSTFTLGFFSPTGVPAKRYLGIWFT
ASPDAVCWVANRDSPLNNTSGVLVVGSTGSLRLLDGSGGHTAWSSNSNTTTTSSPGPSVA
QLLDSGNLVVREQSSGDVLWQSFDHPSNTLLAGMRIGKNPQTGAEWSLTSWRASNDPTTG
DCRTAMDTRGLPGIVSWQGNAKKYQTGPWNGLWFSGLPEVARVSNTDPYPNEVVVRADEI
AYHFDARTDAPFSRLVLNEVGVVQHLAWDPANLLWNILVQAPKDICDNYAKCGAFGLCNV
NTASTRFCSCVVGFSPVNPSQWSLGQYGSGCQRNVPLECHGNGTTTDGFMVVRGVKLPDT
DNATVDTGATMEQCRARCLANCECVAYAAADIRGGGDGSGCIMWTNYIVDIRYVDKGQDR
DRLYLKLARSESERNRRGVAKIVLPVTASLLAAMAVGMYLIWICKLRGPRQNNGNGKKVM
PSTESTSNELGDEEDLEIPSFSFRDIISATNNFSEGNMLGRGGFGKVYKGMLPNNREVAI
KRLGKGSRQGAEEFRNEVVLIAKLQHRNLVRLLGCCIHGDERLLIYEYLPNKSLDCFIFD
PTSKRALDWPTRFKIIKGISRGLLYLQQDSRLTIIHRDIKTSNILLDADMSPKISDFGMA
RIFGGNQQEANTIRVVGTYGYMSPEYAMDGAFSVKSDTYSFGVILLEIAWSLWKDGKAID
LVDSSIVETCSPVEALRCIHIGLLCVQDNPNSRPLMSSVVFILENETTLGSVPKQPMYFS
QWYLEAQGTRENANSSMNDLPSGGDKHVCAVARKRMLSHPQAIWSAKVAHSSKKGVDPCR
QMCHASYSIYGWWWEGGRGGSGKRTHDVEEMKTAVGSSRAHIGLGIIQEKKPPFLTSQTT
FADSRNTKSTSGQRTRKALIDMMYSAIFILIFLSSLCRSDDQLTHTKPLFPKDTLISAGR
DFALGFFSPTNSSNKLYIGIWYNNLPERTVVWIANRDSPITAPTSAKLAISNNSGLVLSD
SQGHIFWTATSNTSGGPGAFAVLLSSGNFVLRSPNDMDIWQSFDHPTDTILPTMRLMLSY
KSQPATHLFAWKGPDDPSTGDISISMDPGSSGLQMFIWNGTLPYFRSSVVSDVLVSRGVY
QTNSTSATYQAMIVDTGDELYYTFTVLAGSPYLRILLHYTGKTRLLIWENSTSSWAVIGE
APSVGCDLYASCGPFGYCDRTKAMPTCQCPDGFELVDSLNFSRGCQRKEELKCRTENYFL
TMPNMKIPDKFLYIRNRTFDQCAAECARNCSCIAYAYSNLSAAGIMGEASRCLVWTHHLI
DMEKASLLENLYIRLGESPADQKKSTFLKILLPTIACLLLLTITALVWTCKGRGKWHKKK
VQKRMMLEYLSSTDEAGGKNIEFPFITFENIVTATDNFSDSNMLGKGGFGKVYKGMLEGT
KEVAIKRLSKSSGQGAKEFRNEVVLIAKLQHKNLVKLLGCCVHEDEKLLVYEYLPNKSLD
YFLFDSARKSMLQWQTRFKIIYGVARGIMYLHHDSRLTIIHRDLKASNILLDKDMSPKIS
DFGMARIFSADQLQANTNRVVGTYGYMSPEYAMEGAFSVKSDTYSFGVLMLEIISGLKIS
SPHLIMDFPNLRAYAWNMWKEGKIEDLVDSSVMENCSPDEVSRCIHIGLLCVQDDPSCRP
LMSVVVSMLENKTTPLPTPNQPTYFALRDSYRPEKAVDNKEFSVNDMSLTVLEGR
Download sequence
Identical sequences jgi|Sorbi1|5042600|Sb06g029725 4558.Sb06g029725.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]