SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5042659|Sb06g030950 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5042659|Sb06g030950
Domain Number 1 Region: 316-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000768
Family EGF-type module 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5042659|Sb06g030950
Sequence length 359
Sequence
MTVAASSRRPTTTIVGAIGALTLQLVATAVAGPIALPGCPESCGGVQVPYPFGIGRGCFH
QGFNLTCDEAQQPAKLLLGEGDGADQVLGISLPDCTVHIQRKISWVQYATEFNGSWSVPT
PPDDDDGPLMVSSARNSFVAFGCNVLAKLIPYNAMVTYTSACAAVCVNTPDASSCSGVGC
CRTSIASLGADLPSYGIQVKHLEGETSYYHRAAFIVDQDWFSRVEAEMARNFSNLFFPVA
VVPVMVDSVPVVLTWSLDLIRDAGLFVLSPIGPQSSDFRCISSNSFSYTIDGNYDRRRCN
CSQGYDGNPYIANGCQDIDECQLPDIYPCHGTCINMPGTYRCSSKKSISSHPGTKYYSL
Download sequence
Identical sequences 4558.Sb06g030950.1 jgi|Sorbi1|5042659|Sb06g030950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]