SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5042660|Sb06g030960 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5042660|Sb06g030960
Domain Number 1 Region: 430-715
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-74
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5042660|Sb06g030960
Domain Number - Region: 330-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5042660|Sb06g030960
Sequence length 768
Sequence
MVPIFRRATIGWVSLQLMVAAAAAAALAGPPVTLPGCRESCGEVSVPYPFGIGVGCFHEG
FGLTCDDTQQPPKLLLLGDDGAVEVLNISLADGTVSINSTVFSSASDTDDDSPVPVLNGT
WSLALPHPPHQASAGPFVLSIEYNWFVAMGCNIVAQLVPVGSEKNAASICAAMCVHDRND
DIISACSGIGLCRTPIKALAPTYHIKVVSVQVSMPTTPTTSQLLDTTHAAAFIVDKAWYS
IYGYDMPSNTTSSYWPQSVPTVLEWWLDRIHDEDMLPGDGDGDGDGPLQFMSRCLSNNSF
IYYSDGKHVKKRCSCSQGYQGNPYIRDGCQDIDECLQPDVYPCRGTCVNVPGTYQCSPNK
STRSLSVPGLITIIAISGGFGLLFSLLGVTKISKKLKQQRARKLKQKFFKRNHGLLLQQL
ISSNEDIAERTKIFSLEDLEQATNKFDQNRILGGGGHGIVYKGILADQRVVAIKRSKIVV
QREIDEFINEVVILSQTNHRNVVKLFGCCLETEVPLLVYEFISNGTLSYHLHGQSERPLP
WKDRLRIALETARAIAYLHCSASISVFHRDIKSTNILLTDTLTAKVSDFGASRSISIDET
GIHTAIQGTHGYLDPEYYYTSRLTEKSDVYSFGVILAELLTRVKPVFSTHSLEVKSLASH
FVTVIKDHRLLDILDPQIVEEGGADDAEVVARLAEACLCLKGEERPTIRQVEITLEGVPG
SKVHSSSRVSRTIQIVQKDQSHNRSKGNEGTTLYSLEKEFIQSFEIPR
Download sequence
Identical sequences C5Y9F0
jgi|Sorbi1|5042660|Sb06g030960 4558.Sb06g030960.1 XP_002447229.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]