SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5043081|Sb07g003780 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5043081|Sb07g003780
Domain Number 1 Region: 545-836
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-74
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 78-198,245-271
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-18
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5043081|Sb07g003780
Domain Number - Region: 418-468
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00294
Family Hairpin loop containing domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5043081|Sb07g003780
Sequence length 862
Sequence
MATMHPSVLFAALLLLLSLQHLHILPPCHAATADTLLPSQGLTGGDTLLSSNGRFALGFF
QAGSQSNFSADGDSTPKWYLGIWFHTVPKLTPVWVANADNPVVAANLTSCKLVISHDGNL
LVILDDDHHHLQPANGSSSSTVWSSKTNATTTNGTTTTTTTTTMAAAAASLLDNGNLVLH
SASNASNIFWQSFDHPTDTLLQGGKIGWIHGTAGLVRRLVSRKNSVDQSPGVYSYELSSS
SSSPSSGSAGSDTSIVSVYNSSTQYWSSGTWGGRYFSNIPETVSQSWLTLSFTTNEQETY
VEYAVEDPTVLSFFVMDVSGQMKVLLWFEGSSTDWQTVYTAPKSQCDVYATCGAFTVCND
VPFPSCACMKGYSIRSPQDWELGDRTGGCARNTPLHCNTTTGGGAAGEPDKFYAMASVQL
PADAQNVGTAKSEDECSVACLGSCSCTAYSYDDDDQQGAGGGCSIWHGKLLNVRQQGNSV
LRLRLAAKEVETSSHTHTSRRGVIIGAAVGATTAATLVGFVFLVMIWVMRKRKRYGDDDV
QGGIGIVAFRYADLQYATKNFSEKLGAGSFGSVFKGSLSDSTTIAVKRLDGVRQGEKQFR
AEVSSTGVVQHVNLVKLIGFCCDGDRRLLVYEYMPNGSLDSHLFQSNGNGNGTVLDWTVR
YQIALGVARGLAYLHASCRDCIIHCDIKPENILLDGSFTPKVADFGMAKFLGRDFSQVVT
TMRGTIGYLALEWISGTAITSKVDVYSYGMVLLEIISGSRNASKQQSSQDGVHEAYFPVR
VACGLVDGDIASLVDANLLGEANMEEVERVCKVACWCIQDVEFDRPTMSEVVQFLECLSE
VETPPVPRFLQSIAGQTNLNIV
Download sequence
Identical sequences A0A1Z5R8K9
4558.Sb07g003780.1 jgi|Sorbi1|5043081|Sb07g003780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]