SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5043267|Sb07g006250 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5043267|Sb07g006250
Domain Number 1 Region: 392-679
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.06e-73
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 18-92
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.5e-24
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5043267|Sb07g006250
Sequence length 721
Sequence
MDSHSYILVIALSGPQGPIVWSANPDNPVSQNAILTFTGEGDLLLQDGGTLIWSTATKNK
SVAGMRLDLSGNLVLFDQNSSLVWQSFDHPTDTLVMGQSLCSGTKLSAKLSNPKWLSSRF
YLSAEGNGLRHYFEPAAYTQLFHPTATSTPTTSSACYAFANGSLGFPDKIFSLPSASSLQ
FMRLESDGHLRLYEMQEQNSPRMLLDVLSTVVAFCDYPLACGDYGVCNSGQCSCPSFSTF
RFQNERLPGSGCIPLSGISCEHAHDHKLIPLNNISYFSNSSFSKLAASGYSEYDCKQSCL
MNCSCQVVIFQNDSGTDVGHCLLLSEKMLILFADDSSNHFSAFVKIQDSPPEKRMVIIVA
SCTAAGFSLMTIFVCAVIWKRRKKDEELLFDVILGTPKRFSFDELKVATSNFSMKLGHGG
FGSVFKGRIGKETIAVKRLEGVEQGTEEFLAEVKTIGRMHHRNLVRLVGFCAEKSHKLLV
YGYLSNGSLDKWIFHTSPVFTLSWRTRRNIIIAVARGLAFLHEECKEKIAHLDIKPQNIL
LDDEFNAKLSDFGLSKMINRDQSKVMTRMRGTRGYLAPEWLGSKITEKADIYSFGIVMIE
IICGRENLDESQPEGSVHLISLLQEKARSGQVSDLVDSSSNDMKSHMEEVMQTMKLAMWC
LQVDSCARPLMSTVAKVLEGVKSLDATPDCTFVPNFASSNIGVAESRSSYVPSESHLSGP
R
Download sequence
Identical sequences jgi|Sorbi1|5043267|Sb07g006250 4558.Sb07g006250.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]