SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5043498|Sb07g014870 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5043498|Sb07g014870
Domain Number 1 Region: 416-699
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-75
Family Protein kinases, catalytic subunit 0.0000905
Further Details:      
 
Domain Number 2 Region: 324-359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000838
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5043498|Sb07g014870
Domain Number - Region: 291-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0356
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5043498|Sb07g014870
Sequence length 757
Sequence
MAIGSAAFAVVLAIAAAAAEPPAPAAPIGLADCNTSCGGVSVPYPFGFGPPRCYWPGFNL
TCDNKSSGELLLLGDGTLRVAEISLRNATVRVVRSGSIIDSASITTDRNVSFGGSFMDHG
YMLSNGNELVLSGCNLVATLVEDLVVGPGRSGIISGCASFCSFRNKKVDSVGQTPGAAGN
NNKYCSGMACCQAPINYHSSPTEVRLRWLDAGNHSEALTFLPTYVFVAEEGWFDQRPLAD
ELLSVKQSPSRAALEVPLVLLWGVRQGLPPLPNLPANATTVCSADADRALCKSDHSVCAA
GNLGYTCQCQQGYDGNPYLTHGCQDINECERPQDHGCFGECINTIGGYKCQCPQGTHGNY
TVRDGCIKSSTTVSAAIFVAQRIKHKRQLMLKQKFFKQNRGQLLQQLVSPRADIAERMII
PVVELAKATNNFDKARELGGGGHGTVYKGILSDLHVVAIKKSKIAVQKEIDEFINEVAIL
SQINHRNVVKLLGCCLETEVPLLVYEFISNGTLYDHLHVEGPKSLSWVTRLRIATETASA
LAYLHSSVSIPIIHRDIKSSNILLEETMTSKVSDFGASRYIPMDKTGLTTMVQGTIGYLD
PMYFYTGRLTEKSDVYSFGVILVELLTRKKPFSYFFHEGDGLVSHFVNLLATENLAEILD
PQVIHEGGKEVHEVSILAASCIKLNAEDRPTMRQVEHALEGLVSKKYVQTDMNVETNEEN
DIVMMNCSVKMERQSTQEWSRRYSMEEEILMSARYPR
Download sequence
Identical sequences jgi|Sorbi1|5043498|Sb07g014870 4558.Sb07g014870.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]