SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5044179|Sb07g027586 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5044179|Sb07g027586
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5044179|Sb07g027586
Sequence length 47
Sequence
DIDECENQEANSCYGICLNSPGSFQCQCPRGTYGSPWTKGGCTSIKD
Download sequence
Identical sequences jgi|Sorbi1|5044179|Sb07g027586 4558.Sb07g027586.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]