SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5044180|Sb07g027590 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Sorbi1|5044180|Sb07g027590
Domain Number - Region: 222-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0024
Family Laminin-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5044180|Sb07g027590
Sequence length 258
Sequence
MGFSRLFLVYLLVMMAVPGLAAADVPMARSPDGATRCGHIDVPYPFGLEAHCAIHSGFHL
SCTKTVDGTSKLLLNNTLEVIKISVQHNKCYDQSTKAMVSNEERMNITSTPYVLSRSDNK
LIVLGCTSFSYIKTCTVNLPRFTHVTQGSFHMLRNTTDPIWGEYPCNYVTMVETKAFKFS
TTYLTSTAFYDTDNATVPVVMEWGIAKMKCNKTAENDKNVPYACVANNSKCVHNDAGYAC
NCSSGYKGNPYLVNGCTG
Download sequence
Identical sequences 4558.Sb07g027590.1 jgi|Sorbi1|5044180|Sb07g027590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]