SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5044182|Sb07g027610 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Sorbi1|5044182|Sb07g027610
Domain Number - Region: 269-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5044182|Sb07g027610
Sequence length 317
Sequence
MEFSRRLLLLCLPVVVWVLGSAAAAAAIDDVPVSPRPNCPTTARCGDIDVPFPFALERRC
AINNDKRFHLNCTETVGGTKLFNGKLEVINISVQDNKAWIKTRISRQRYNESAIKGLTTK
GERMNIIGTPYVLSRQDNKIIVLGCNRIVSYIISSYYRVGCLPTCVENPVKGTCHPNAGC
CQLDLPKDVKSTEALFVQLNNNNSQTWREYPWNYVTVMDKEAFEFSTTYLTSTAFYDANN
AGVPVVMEWGITNNKKCKDPKILKNGSACVSKNSECTETDAGYACKCSEGYEGNPYLING
CKEALTGHVMAYVIVLS
Download sequence
Identical sequences jgi|Sorbi1|5044182|Sb07g027610 4558.Sb07g027610.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]