SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5044220|Sb07g028200 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5044220|Sb07g028200
Domain Number 1 Region: 419-706
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-72
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 320-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000519
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5044220|Sb07g028200
Domain Number - Region: 283-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000436
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5044220|Sb07g028200
Sequence length 763
Sequence
MNTNVVVASKTVVALAALVATTLPMLPPSSAAQAAATATTTATGLGSTSCTRTCGNISIP
YPFGVEPGCYHAAGFNLTCKQQHSHHHHHQPPKLFLGDGTVQVLDISVEHNTVCINSPGV
QLQYDSISQIGPANGTWGLGLPKTGPYFLSESASMVEAIGCSIQVSILGGLNNSLVSSCT
AICPLIFSKGGGVSGTIGNGNCTGIGCCRASIVVGYSSYTIQIERISGPGWYVPTSVFIV
DQSFFVSINSNGERIPGSLTTATLDWIIGTSTCPTNNKTAPECLSSHSYCQNSSSLGHGG
YTCQCANGYQGNPYVHGGCQDIDECKYPNQYVCYGVCKNTPGSYICQCNTGYTGNASIPN
GCTGLSIGLGVGGGTGLLLLALGGPYIMHKIKLQKANKVKQRLFKQNHGLLLQQLISHNT
DISERMIITLSGIEKATNNFDKARIVGGGGHGVVFKGILDLQVVAVKKSKIVVQREINEF
INEVAVLSQVNHRNVVKLLGCCLETEVPLLVYEFISNGTLCHHLHIDGPISLPWDDRMRI
ATEVAKALSYLHSAASMPVFHRDIKSANILLDDALTAKVSDFGASRYIPIDQTGVTTVVQ
GTMGYLDPMYYYTGRLTDKSDVFSFGVLLVELLTRKKPYVYRSVDNDGLVSHFVSLLAEG
KLVDIIDPQVMEEKGGEIQEVITLAAMCTKLKGEDRPTMREVEMTLESLLVNKKRLVQYN
GTPMSNCGDEATTHYMAIGRDCNEASRQYTMEEEIWLSASYPR
Download sequence
Identical sequences jgi|Sorbi1|5044220|Sb07g028200 4558.Sb07g028200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]