SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5044803|Sb08g006890 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5044803|Sb08g006890
Domain Number 1 Region: 489-779
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-74
Family Protein kinases, catalytic subunit 0.00034
Further Details:      
 
Domain Number 2 Region: 64-159,191-223
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.24e-30
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5044803|Sb08g006890
Domain Number - Region: 356-412
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000804
Family Hairpin loop containing domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5044803|Sb08g006890
Sequence length 805
Sequence
MAYLHILIVLLLISLQVPGNSATTTRDTISAGQAALSIHDKLVSQNGRYALGFFEAGSSQ
NTTNWYLGIWFNSIPKFTVGWVANRNDPMKNHTSLELKISHDGNLVVTNRPTDSIVWSTQ
ATMKRNNTIAVLLNSSNLVLRDASNSSDILWQSFDHPTDTLFQWAKLGWDNVTGLNRRLV
SKKNSISPATGFYYEELDPSGVNQIVLASLKSSKPYWSSGVWNGKRFNSSPEVSRNVGYL
SFVETTHEKYHTFHVSDEMNIYYNLGVSGQTNVFIWPEGSQDWVLAHAEPRSQCDVYAAC
GPYTICDDDALPHCTCLKGFSVTSIEDWELDDHSNGCSRNTALDCNFSNESSIRSMDKFL
SIPCVSLAQSERKTEDAKSSGECAQVCLANCSCTAYSFSNNTCFIWHEELLNVRQIQCGA
TADSNGETLNLRLAAKDMQSLEKNKRVFTIGVAVGSSAAALCLFAFIMLIMIWRNKRKSS
CRISQTAQGCNGIITFRYIDLQCATKKFSEKLGQGGFGSVFKGFLSDSTAIAVKRLDYAH
HGEKQFRAEVKSIGIIQHINLVRLVGFCCEGAKRLLVYEHMLNGSLDIHLFRSQVTLLKW
STRYQIALGVARGLTYLHEGCCDCIIHCDIKPENILLSDSFIPKIADFGMAKFLGRDFSR
VLTTFRGTIGYVAPEWIAGVAITPKVDVYAYGMVLLEIISGQRNTSVSCSCSSSNHDIYY
PVHVARTIVEGDVMSLLDHRLNGEANSKQVEIACKLACWCIQDDESNRPTMAKVVQTLEG
LLEINIPPMPRLLQAISGSSSFTCF
Download sequence
Identical sequences C5YTR3
4558.Sb08g006890.1 jgi|Sorbi1|5044803|Sb08g006890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]