SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5044883|Sb08g008420 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5044883|Sb08g008420
Domain Number 1 Region: 531-832
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.25e-71
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 72-168,195-224
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.11e-22
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5044883|Sb08g008420
Sequence length 839
Sequence
MSTTLAVAVAAALQLIGLGFLLLPLPPAGAARGDILTRDGGAIAVEDHATDFLVSPDGTF
ACGFYNVSPTVFTVSVWFARAADRTVVWTAAPGRPVHSTGARLALDRRGGALVLTDYDGA
VVWNSTAVTGAQTQLPTASRARLHDTGNLVLEDASGNALWQSFDSPTDTLLPTQRFTAAR
HLVSRGGRGRLLAAGYYSLGFSDYAMLSLFYDNHNVSSIYWPNPYNNYVANKRKIYNFTR
DAALDALGRFLSSDDASFVAADLGAGAGVRRRLTLDADGNLRLYSLDVATGAWALSWAAF
GNPCTIHGVCGANAVCLYAPAPACVCAPGHERADPGDWTRGCRPVFRRDCSRPTKLVTLP
HTDFWGYDLNDGEIIPFHACARRCRDTCACVAFQHKQNMECYLKSVLFNGRTFPGLPGTV
YLKVPADFHVPELQVHQWRQSQDGGLAIQEDIARCDDDDGTNPGTEVFLNVSTYSSTSDA
GKPVWPYLFGFLSALLVVEAIIIGLGCWLFSRRGLFRPSRVWAIEEGYKLITSNFQRYTY
SEIKRATGDFTSVIGSGGSGVVYKGILGDDRVVAVKVLKNVSQSEQEFQSELSVIGRIYH
MNLVRMWGCCSQGKHRFLVSEFIENGSLAEMLFHREREMASDAAVLGWDQRFRIALGVAK
GLAYLHSECLEWIIHCDMKPENILLDKDLEPKITDFGLAKLLNRDGSDADLSRIRGTRGY
MAPEWVSSLPITEKVDVYSYGVVLLELVKGVRISEWVIHGVRLADTDTRMVVKAVQEKMA
IHGHESCVEDLIDHRLNGEFNRVQAMAMIKVAVSCVEEDRGKRPNMSSVLHAILSVEDE
Download sequence
Identical sequences C5YU14
4558.Sb08g008420.1 XP_002443099.1.57931 jgi|Sorbi1|5044883|Sb08g008420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]