SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5045219|Sb08g017550 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5045219|Sb08g017550
Domain Number 1 Region: 382-722
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.15e-111
Family Motor proteins 0.00000101
Further Details:      
 
Domain Number 2 Region: 26-159
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.29e-21
Family Calponin-homology domain, CH-domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5045219|Sb08g017550
Sequence length 959
Sequence
MAAAAVLEEAMRRGTGSVGDDDVAARRAEEAAIRRHEAASWLRKTVGAVCAKDLPEEPSE
EEFQLGLRNGIVLCNALNKAQPGAIPKIVGVPSDTAVPADGSALCAYQYFENLRNFLVVI
QDFGLPTFEVSDLEKGGKSVRIVDCILALKSFSESKKTGRQAACKYGGIPKPLASGKYFI
LKNSDAFMNKNARMHSEEATQNAFPGEQKLSPDCSPESYEVTTTDSLSAVVRTILLDKKP
EEVPLIVESLLSKVIQEYEHRFANQNLMDEEKQNILTTKEEANFAVNGSNAAQKFQLKEE
INFDLQHKQIKELRGTVSSIKSGMEQLKWHYSEEFTKLGKHLYSLSNAASGYHKVLEENR
KLYNQIQDLKGIILCIEGAEGNIRVYCRVRPFLPGQISSLSSVAGMEERTIAIMTPTKYG
KDGSKSFTFNKVFGPAATQDEVFSDMQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPKV
LTEESLGVNYRALNDLFNLQAQRKGTIDYDISVQMIEIYNEQKGLAVPDASMVPVTSTSD
VVELMNQGQKNRAVGSTAINDRSSRSHSCLTVHVQGRDLTSGTVLRGCMHLVDLAGSERV
DKSEVVGDRLKEAQYINKSLSALGDVIASLSQKNTHVPYRNSKLTQLLQDSLGGQAKTLM
FVHISPELDAVGETISTLKFAERVASVELGAAKPNKEGSEIRELKEQVSTHFLWLISVRK
RLQIAFLKAALAKKEGEPENILSTQSSPSIYRIRKGNATPAAPKDRQPMEEDGNLEVQNV
FTPAQKRSKMHLSGILTENNSSNSVQNCNGPQKEIRLGGWVDKMALGDDHFENSNSNVEL
EPDTAQLPTSFYQIHSPMQQSCRTESIPSVGLHGFDSATSCSNQEIGMSTMGLKASRIAN
RGASTIKKPEATSMRSSNLASKSPLSQKKLQTPTRNRNQLTLSSIGGRRTPNGKIGIAK
Download sequence
Identical sequences 4558.Sb08g017550.1 jgi|Sorbi1|5045219|Sb08g017550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]