SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5045500|Sb08g021220 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5045500|Sb08g021220
Domain Number 1 Region: 216-284
Classification Level Classification E-value
Superfamily RING/U-box 8.83e-19
Family RING finger domain, C3HC4 0.004
Further Details:      
 
Domain Number 2 Region: 83-151
Classification Level Classification E-value
Superfamily PA domain 0.0000000127
Family PA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5045500|Sb08g021220
Sequence length 550
Sequence
MATAQIKSRFLVLYVIVCLMAQMGDANVVLLGNNLTLSFDDIEASFSPGVKGSGVNGVVY
ASEPLDACSPLTIKAVKGPPSPFALIVRGGCTFDEKVKNAQDAGFKAAIVYDNENSGVLV
SMAGSSSGIHIYAVFVSKASGEVLKNFSGHTDVEVWILPTVENSAWSIMGISFISLLAMS
AVLATCFFVRRHRIRRDHPRIPEAREFHGMSSQLVKAMPSLIFTKVQEDNCTSSMCAICL
EDYSVGEKLRVLPCRHKFHAACVDLWLTSWRTFCPVCKRDAMSGVSEFPATEATPLLSSA
VRLPSRPSSFRSSVAASPPRPISRHPSSHSVSRAYSVSSTPQSPNPFRSRTNLPGIHTSR
STADLANMSSPHPRISHLSSAHSLVGSHLSPPISIRYSLPQLAQSGHGSLSPHVSSSYIS
NSGYGSSSYYYLGGSSQHGSYLRRCGESGPSLSTMAPQSPQQFQSEANVVAGTSSAQSFR
QSYLRHCGDSDASLSDMMSAQSLPQQFQSDANVAAGASSAQSLRQSYLRRCGDSDASLSD
MTSAQSLPGC
Download sequence
Identical sequences C5YRW5
4558.Sb08g021220.1 XP_002442517.1.57931 jgi|Sorbi1|5045500|Sb08g021220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]