SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5045767|Sb09g001740 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5045767|Sb09g001740
Domain Number 1 Region: 528-815
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.92e-78
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 87-185,217-245
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.98e-22
Family alpha-D-mannose-specific plant lectins 0.0069
Further Details:      
 
Domain Number 3 Region: 393-448
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000216
Family Hairpin loop containing domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5045767|Sb09g001740
Sequence length 838
Sequence
MPPLYPVLVVGFAVFLFCVLHAPCSAATAIGDTLAAGQALAAGDKLVSRNGKFALGFFQF
QQSLGGRTTGESIDNTTTTTTISSPGWYLGIWFNKIPVFTPVWVANRERAITRSELLITQ
FHVSIDGNLIISSAGSVIWNSTIVVSSTNSSTYIIVLKNTGNLALVPNTSSNGEPLWQSF
DYPTDAALPGVKIGRNKVTGFSHQLISKKSLIDPDLGSYSLNIHTDGVLQLKTRNTPVVT
YWSWPSGKLGVLVSTMSALIDVDPRAKGLLKPTYIDNDKEVYFTYTIMNESTSTFFPIDT
SGQLKLMLWSEANQTWETIYAQPSDFCITYAVCGPFTICNSNSGPLPCDCMETFSMKSTQ
EWELGDRTGGCVRNTPLDCRTNNKSNASSTDVFHPIPHVTLPYDPQRIEDVTTQSDCAEA
CLHDCSCNAYSYSDSYSNCSIWHGELLNVNQDDGNGISSQDVLYLRLAARDFQGTTKKNK
RIPRVVIVACIVGFGLIMVMVLLMIWRNRLKWCYHPSHDNDIQGSGEGIVAFKYTSLCRA
TKNFSERLGGGGFGSVFKGVLSDSTTIAVKRFDGDRQGENQFRAEVSSIGMIQHINLVKL
IGFCCEGDERLLVYEHMSNGSLDSHLFKSNASFLINWSTRYQIAIGVARGLRYLHHSCHK
CIIHCDIKPENILLDASFIPKISDFGMSAIVGRDFSRVLTTFRGTTEYLAPEWLSGVPIT
PKVDVYSFGMVLLEMISGRRNSLELHSSNSYHDAYFPVQAITKLHEGDMWSLVDTQLQGD
FDLAGVERVCKVACWCIQDNEVHRPTMVEVVHFLEGLKELDMPPMPRRLAAIAERSNV
Download sequence
Identical sequences 4558.Sb09g001740.1 jgi|Sorbi1|5045767|Sb09g001740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]