SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5045770|Sb09g001750 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5045770|Sb09g001750
Domain Number 1 Region: 84-201,237-264
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.06e-17
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 
Domain Number 2 Region: 549-608
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000208
Family Protein kinases, catalytic subunit 0.0095
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5045770|Sb09g001750
Domain Number - Region: 435-476
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00122
Family Pan module (APPLE domain) 0.019
Further Details:      
 
Domain Number - Region: 608-676
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00248
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5045770|Sb09g001750
Sequence length 688
Sequence
MLPPNPIYVAVALAAALIFFSSLHTSAAADGDTLAAGQALAAGDKLVSRNGKFALGFFQF
RQTLPGGGSDDGITNSTIISSPGWYLGVWFNKIPVCTPVWIANRDRPITESELKVSQLRI
STSDGNKLIVTNNTSTDESPIWSSAVTVTVTNSTTNASSVHAVLMNTGNLALLPAETISA
STAAAPTSSSYLWQSFDYPTDVGLPGAKIGWNKVAGGKPDFDRQFISKKSLIDPSPGSYS
INIDPNGFMQLTTRNAPFVTYWSWTSGRLEELVPALTALINMDLRTKGLLVPDYVETADE
VYFTYSITNESASVFVPIDITGQLKLMLWSEAKQSWETIYAQPSDFCLTFGVCGPFTVCN
GNSGSGTSSSCGCMETFSLTSPRDWGLSDLTGGCARRTPLDCKGSTNRSSSSSGSTDVFH
PIAQVALPYNPRGIEGAAAQSDCAEACLGDCNCTAYSYSNNGKCSVWHGDLLSVNKADNN
SISSQDVLYLRLAKSDFQSLNKTNKKTPAVAIAASAVGSGLLVLMLVFLIWRNRFRWCNA
HSIQDGGGGIIAFKYTDLSRATKNFSERIGGGGFGSVFKGVLSDSTAIAVKRLDDARQGE
KQFRAEAIRKLHEGDLQSLVDPQLQEDLNLEEAERLCKVAFWCIQDNECDRPTMVDVVRV
LEGLQELDMPPMPRLLAAITERANAELM
Download sequence
Identical sequences jgi|Sorbi1|5045770|Sb09g001750 4558.Sb09g001750.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]