SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5046342|Sb09g017130 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5046342|Sb09g017130
Domain Number 1 Region: 514-809
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-76
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 85-175
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-24
Family alpha-D-mannose-specific plant lectins 0.0043
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5046342|Sb09g017130
Domain Number - Region: 358-396
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00169
Family Hairpin loop containing domain 0.087
Further Details:      
 
Domain Number - Region: 216-284
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0023
Family alpha-D-mannose-specific plant lectins 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5046342|Sb09g017130
Sequence length 818
Sequence
MVADLLAALALAIILSTLAATAAPHDTLPRKSSLVVEEYETQILRSSPDGTFSCGFYEIY
DGAFTFSIWYTNSADDKAATATVVVIWSANRGSPVHSWGAAVTLRKDGSMVLTDYDGTVV
WQTQGRFPDVQYAQLLHTGNLVIKNSSGDIVWQSFDSPTDTFLPGQRIAETSKLVSTTQL
QVPGHYTFRFSDQSLLSLIYDDTNVTSVYWPDPDFQYYENSRNLYNSTRIASLGDSGEIF
SSDFANSHVLAASDRGTGIQRRLKLDQDGNLRLYSLNNSDRTWSVSWIAESQPCKTHGLC
GPYGICHYSPTPVCSCPPGYRMKNPGNWTQGCLPVVDISCDGEQNVTFLELPNTDYWGSD
QQRIEKVPWETCWNACISDCSCKGFQYQEGNGTCYPKSLLFNGRSFPTPTVRTMYIKLPS
SLDASKLSIPQSNVLDSVPHQLRCDPVISTINMDKNLSYFHRPNQEEPKWIYFYGFIGAF
FVIEVFFFAFAWFFVLRRELRSSQVWAAEEGYKMMTNHFRMYSYRELVKATEKFAHELGW
GGTGVAYKGILDDDRVVVVKKLGNIRHSREEFHDELHVIARINHMNLVRIYGFCSERSHR
MLVLEYAEKGSLADLLFKSKTSLDWKQRFNIALGVAKGLAYLHHECLEWIIHCNLKPENI
LLDQDLEPKITDFGLAKLLSRSGPTQNVTRARGTVGYIAPEWISGLPITAKADVYSYGVV
LLELVSGTRVFDLVKGEDERVHVILKKFIKMISYRLDKDEPFWIAEFVDLRLGGEFNYSQ
VKGLIKLAVSCLEEERKKRPTMESVVESLLSVNLAGSQ
Download sequence
Identical sequences jgi|Sorbi1|5046342|Sb09g017130 4558.Sb09g017130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]