SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5046722|Sb09g023490 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5046722|Sb09g023490
Domain Number 1 Region: 66-161,193-225
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.45e-27
Family alpha-D-mannose-specific plant lectins 0.0028
Further Details:      
 
Domain Number 2 Region: 389-471
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000168
Family Protein kinases, catalytic subunit 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5046722|Sb09g023490
Sequence length 513
Sequence
MHPAFFLLVHLLYSMHAPACSATTDCISAGEALIGDAKLVSSNGRYALGFFHPGSKSSIR
HTPKHWYLGIWFYKVSQLTPIWVANRESPVIGHQRMTKLAIFEDGNLAIFNQATKSVVWS
THASIMAKNSTAVLLDNGNLVSKDATNSSNILWQSFDYPTDIVSPGAKFGIDKTTGLNRR
VVSKRSMIDPSPGRYCQELDPTSAPQFVFKLCNTSIVYWSTGEWNDQYLNAMPEMSGRTL
FNYKFINNNKEEYFQSILLEKDLISISILDISSQNKLLIWLEDKQEWTTIYTQPKDLCGI
YATCGPFTICNSNAPLPCDYMRGFSVSGDGCSLWYDDLLNIRSYTNGTTDDGGILYLRIA
AKDAYNWRNSANGIIAFRYIDLQNATKKFSGRIGSGGFGSVFKGLLTDSTTIAVKRLDGV
RQGEKQFRAEEGNLAGYLAPEWMGGVAITSKVDVYSYGMLLIDIILGRRNTCKGNTSGDV
HVACFPVEVASKLLNGDIGSLLDVQLSGHANLG
Download sequence
Identical sequences jgi|Sorbi1|5046722|Sb09g023490 4558.Sb09g023490.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]