SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5047534|Sb1334s002010 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Sorbi1|5047534|Sb1334s002010
Domain Number - Region: 12-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000273
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5047534|Sb1334s002010
Sequence length 86
Sequence
METPPRGIPLSDPCLVVNCGQGGQCEKGAGVSYQCRCQPGFKNMLDDTSMPCIGSSCTFG
ADCAKLGLGNTPAAPAPAPVIGNYLY
Download sequence
Identical sequences C6JSL5
jgi|Sorbi1|5047534|Sb1334s002010 4558.Sb1334s002010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]