SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5047644|Sb01g000350 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5047644|Sb01g000350
Domain Number 1 Region: 122-171,199-402,524-651
Classification Level Classification E-value
Superfamily Subtilisin-like 8.51e-76
Family Subtilases 0.016
Further Details:      
 
Domain Number 2 Region: 34-119
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000629
Family Subtilase propeptides/inhibitors 0.0095
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5047644|Sb01g000350
Domain Number - Region: 416-498
Classification Level Classification E-value
Superfamily PA domain 0.000118
Family PA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5047644|Sb01g000350
Sequence length 793
Sequence
MARRRQRSLLLVAVVQFLSLCVAEWHLHLVEAYKKSYIVYLGAHSYGRDASAEEHARATQ
SHHHLLASILGGDDETARQSIFYSYTKSTLNGFAAHLEESVAQQIQEHPEVVAVVESKML
QLHTTRSWDFMDLERDGHVLPGSIWNHAKFGQDVIIASLDSGVWPESHSFADDGGDLAEA
VPARWKGTCQDTVKYGVACNRKLIGARFFNRDMLLSNPSVVGANWTRDTEGHGTHTLSTA
AGSFVPRASLFGYANGTAKGGAPRARVAAYKVCWSGECAAADVLAGFESAIHDGADVISV
SFGQDAPLADDAKSLFQEPVTLGSLHAAVHGVSVVCSAGNSGPYDNTIVNAAPWVTTVAA
TTVDRDFPNVLTLGNSVRLKGMSLESTTLHSNTLYPMVDAARAASATSNTYDASSCALGT
LDPAAVKGKIVVCRRGGGGGGGGGQVSRVTKGMAVLDAGGAGMILANDRMDGEDIVADAH
VLPATMITYSEAVSLYAYMASTANPVANISPSKTEVGVKNSPSVAGFSSRGPSGTLPYVL
KPDIAAPGVDILAAFTEYVGPTELASDKRRSEYAILSGTSMSCPHVSGIIALLKAARPEW
SPAAMRSAIMTTARTQDNSGAPIRDHDGREANAFAYGAGNVHPNRAVDPGLVYDATPDDY
FTFLCSMGFSEADMKRLSAGKFACPAKVPAMEDLNYPSIVVPSLRGTQTVTRRVKNVGRP
AKYLASWRAPVGITMEVKPTVLEFSKGVGEEEEFKVTVTSHKDKIGLGYVFGRLVWTDGT
HYARSPVVVNALA
Download sequence
Identical sequences C5WRU9
jgi|Sorbi1|5047644|Sb01g000350 XP_002463463.1.57931 4558.Sb01g000350.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]