SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5047759|Sb01g001980 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5047759|Sb01g001980
Domain Number 1 Region: 481-777
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-76
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 78-171
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-21
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5047759|Sb01g001980
Domain Number - Region: 208-265
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0288
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5047759|Sb01g001980
Sequence length 858
Sequence
MRPLRRSSGDLAAFGCCLFLLLPLLSRGADMPVGSTLSPGNSATWTSPNSTFSLGFTASA
SSPSLFVAAISYAGGVPVWSAGDGAAVDSRGSLRLSSNGDLQLVNGSGTVLWSTNTGGQN
VSAAAVQESGNLVLKDSRGATLWQSFDHPTDTVVMSQNFTSGMNLTSGSYVFSVDKATGN
LTLRWTSAATTVTYFNKGYNTSFTGNKTLTSPTLTMQTNGIVSLTDGTLTSPVVVAYSSN
YGESGDMMRFVRLDADGNFRAYSAARGSNTATEQWSAVADQCQVFGYCGNMGVCSYNGTA
PVCGCPSQNFQLTDASKPRGGCTRKADLASCPGNSTMLQLDNTQFLTYPPEITTEQFFVG
ITACRLNCLSGSSCVASTALSDGSGLCFLKVSNFVSGYQSAALPSTSFVKVCYPPQPNPV
PGSTTGAPSRGGPGVRAWVVAVVVLAVVSGLVLCEWALWWFFCRHSPKFGPASAQYALLE
YASGAPVQFSYREMQRSTKGFKEKLGAGGFGAVYRGVLANRTVVAVKQLEGIEQGEKQFR
MEVATISSTHHLNLVRLIGFCSEGRHRLLVYEFMKNGSLDAFLFGGDRDAPPPGGKMPWP
TRFAVAVGTARGITYLHEECRDCIVHCDIKPENILLDEHFNAKVSDFGLAKLVNPKDHRH
RTLTSVRGTRGYLAPEWLANLPITAKSDVYSYGMVLLETVSGRRNFDVSEETGRKKFSVW
AYEEYERGNLAGIVDRRLPAEDLDMAQVERAVQVSFWCIQEQPAQRPSMGKVVQMLEGVM
ELERPPPPKSSDSFLSTTTATSAVSSSMVSTVVSSGAPVAPAPSPTLEQEMALGRSESAR
NRERVSRQLLSPQPYMTM
Download sequence
Identical sequences XP_002463561.1.57931 jgi|Sorbi1|5047759|Sb01g001980 4558.Sb01g001980.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]